PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 238aa    MW: 27511.1 Da    PI: 5.0495
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940228.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85e-5461331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv+++Lk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+
  XP_010940228.1   6 LPPGFRFHPTDEELVNYFLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVV 99 
                     79****************************.99**************85335566888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + +++++g+kktLv+y+grap+g +tdWvmheyrl
  XP_010940228.1 100 C-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                     *.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-634157IPR003441NAC domain
PROSITE profilePS5100559.1176156IPR003441NAC domain
PfamPF023654.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYFLKRKIHG LKIELDIIPE VDLYKCEPWE LADKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVVC QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKECED TMGIQDSYAL CRVFKKNVVC TEIELRGQYS LMVMEGTQGV  180
ITSESETMSP DVPVGSSSCF DEDDKDDAWM QFISDDAWCS NVSSNAVVKD PSYMDFAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-53215711169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940228.11e-180PREDICTED: NAC domain-containing protein 45-like
SwissprotA4VCM01e-90NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM0SEF51e-149M0SEF5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P13880_0011e-148(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-125NAC domain containing protein 57